PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g23320.6.p
Common NameBRADI_2g23320, LOC100843050
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 525aa    MW: 58194.6 Da    PI: 6.3926
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g23320.6.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.41.9e-192874148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEd+ +vd vk++G++ W++Ia+ +  gR +kqc++rw+++l
  Bradi2g23320.6.p 28 KGPWTQEEDDTIVDMVKKHGPRKWSLIAKSLD-GRIGKQCRERWHNHL 74
                      79******************************.*************97 PP

2Myb_DNA-binding63.54.2e-2080122145
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       + +WTteE++ lv+a++++G++ W+ Ia+ ++ gRt++++k++w+
  Bradi2g23320.6.p  80 KEAWTTEEEQVLVKAHHLHGNR-WAEIAKLLP-GRTDNSIKNHWN 122
                       579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.356122IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.601.6E-11335IPR009057Homeodomain-like
PROSITE profilePS5129431.4682378IPR017930Myb domain
SuperFamilySSF466892.21E-3125121IPR009057Homeodomain-like
SMARTSM007176.6E-172776IPR001005SANT/Myb domain
PfamPF002491.5E-172874IPR001005SANT/Myb domain
CDDcd001672.26E-153074No hitNo description
Gene3DG3DSA:1.10.10.607.0E-273682IPR009057Homeodomain-like
SMARTSM007171.7E-1779127IPR001005SANT/Myb domain
PROSITE profilePS5129423.56179129IPR017930Myb domain
PfamPF002498.6E-1880123IPR001005SANT/Myb domain
CDDcd001672.74E-1482122No hitNo description
Gene3DG3DSA:1.10.10.603.9E-2383128IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 525 aa     Download sequence    Send to blast
MKAESFPDRT EVQCLHRWQK VLDPELIKGP WTQEEDDTIV DMVKKHGPRK WSLIAKSLDG  60
RIGKQCRERW HNHLDPQIRK EAWTTEEEQV LVKAHHLHGN RWAEIAKLLP GRTDNSIKNH  120
WNSSVRKRID DYSTRTVMPV PLHATHIDLK HAAELSSAEN HIDLNKEPSI SLKDRPVIVD  180
HSDLIQSPRV CSLKNIKGCS DFLSLAMPTA QPLTLCEASV SDDSAVALAI MGLKMDSGHD  240
KDMQLKCVSE NSLEISLSNE RGLKIDLITN KMRPSGLGKS EGEIANIGCE SPSQNEAGSL  300
GSLCYWIPML DDTDLAHSPV FSTHNVRENS GIGFQSPTGY TTPSPTEGKK SDQLSVESIL  360
KSAAENFPST PSILRRRKRE KPTPAQDCEL RIETNSDSFE TPIGNFTTDS PHSFKTASFL  420
SFSHLDDQGL PADLGKCDVS PSYRLRSKRM AVLKTIEKHL DFSSDAMDIC DTSGVLKSAC  480
RNSESINSST DISSVEDEKM GAGHMIGLET LINDFAHTRK LDAS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C1e-62312933159MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-62312933159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1374381RRRKREKP
2375380RRKREK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010231306.10.0PREDICTED: uncharacterized protein LOC100843050 isoform X2
RefseqXP_010231307.10.0PREDICTED: uncharacterized protein LOC100843050 isoform X2
TrEMBLA0A0Q3QXM60.0A0A0Q3QXM6_BRADI; Uncharacterized protein
STRINGBRADI2G23320.10.0(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.29e-72myb domain protein 3r-5